Orthogonal Strategies: Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in human cell lines SK-MEL-30 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human breast cancer shows moderate to strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Simple Western: PHGDH Antibody [NBP1-87311] - Simple Western lane view shows a specific band for PHGDH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: PHGDH Antibody [NBP1-87311] - Electropherogram image(s) of corresponding Simple Western lane view. PHGDH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
Knockdown of PNKP or TDP1 leads to increase in expression of PSAT1 and PHGDH. Western blot analysis of XRCC1, PHGDH and PSAT1 expression upon KD of PNKP (A) or TDP1 (B). beta -Actin served as a loading control. (C) ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHGDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
WB reported in literature (PMID:30037819). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Reactivity reported in scientific literature (PMID: 22438825)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for PHGDH Antibody
3,3-phosphoglycerate dehydrogenase
3PGDH
3-PGDH
D-3-phosphoglycerate dehydrogenase
EC 1.1.1
EC 1.1.1.95
MGC3017
PDG
PDGH3
PGAD
PGD
PGDH
PHGDH
phosphoglycerate dehydrogenase
SERA
Background
3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PHGDH Antibody and receive a gift card or discount.
![Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in human cell lines SK-MEL-30 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Western-Blot-NBP1-87311-img0018.jpg "Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in human cell lines SK-MEL-30 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87311-img0016.jpg "Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Immunohistochemistry-Paraffin-NBP1-87311-img0013.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.")
![Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Western-Blot-NBP1-87311-img0015.jpg "Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Immunohistochemistry-Paraffin-NBP1-87311-img0010.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.")
![Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human breast cancer shows moderate to strong cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Immunohistochemistry-Paraffin-NBP1-87311-img0011.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human breast cancer shows moderate to strong cytoplasmic positivity in tumor cells.")
![Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Immunohistochemistry-Paraffin-NBP1-87311-img0012.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.")
![Simple Western: PHGDH Antibody [NBP1-87311] - Simple Western lane view shows a specific band for PHGDH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/PHGDH-Antibody-Simple-Western-NBP1-87311-img0007.jpg "Simple Western: PHGDH Antibody [NBP1-87311] - Simple Western lane view shows a specific band for PHGDH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: PHGDH Antibody [NBP1-87311] - Electropherogram image(s) of corresponding Simple Western lane view. PHGDH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/PHGDH-Antibody-Simple-Western-NBP1-87311-img0008.jpg "Simple Western: PHGDH Antibody [NBP1-87311] - Electropherogram image(s) of corresponding Simple Western lane view. PHGDH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
![Western Blot Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Western_Blot_11636.jpg)
![Immunocytochemistry Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Immunocytochemistry__Immunofluorescence_19604.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")