![Western Blot: PGAM5 Antibody [NBP2-93600] - Analysis of various lysates, using PGAM5 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Western-Blot-NBP2-93600-img0007.jpg "Western Blot: PGAM5 Antibody [NBP2-93600] - Analysis of various lysates, using PGAM5 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-146 of human PGAM5 (NP_001164014.1). GARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PGAM5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Yongkang Yang |
WB | 12/20/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PGAM5 Antibody (NBP2-93600)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PGAM5 |
![Immunocytochemistry/Immunofluorescence: PGAM5 Antibody [NBP2-93600] - Analysis of MCF7 cells using PGAM5 Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93600-img0008.jpg "Immunocytochemistry/Immunofluorescence: PGAM5 Antibody [NBP2-93600] - Analysis of MCF7 cells using PGAM5 Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP2-93600] - Human tonsil using PGAM5 Rabbit pAb (NBP2-93600) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP2-93600-img0003.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP2-93600] - Human tonsil using PGAM5 Rabbit pAb (NBP2-93600) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP2-93600] - Human colon carcinoma using PGAM5 Rabbit pAb (NBP2-93600) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP2-93600-img0001.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP2-93600] - Human colon carcinoma using PGAM5 Rabbit pAb (NBP2-93600) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP2-93600] - Human liver cancer using PGAM5 Rabbit pAb (NBP2-93600) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP2-93600-img0002.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP2-93600] - Human liver cancer using PGAM5 Rabbit pAb (NBP2-93600) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: Rabbit Polyclonal PGAM5 Antibody [NBP2-93600] - Whole cell lysates from MDA-MB-231 and SUM159 cells were loaded with 50 ug/lane. 10% SDS-PAGE. PGAM5 Antibody (NBP2-93600) was used for primary antibody: 1:1000, 4℃, overnight. Image from a verified customer review.](http://images.novusbio.com/fullsize/nbp2-93600_rabbit-polyclonal-pgam5-antibody-western-blot-3112024141643..png "Western Blot: Rabbit Polyclonal PGAM5 Antibody [NBP2-93600] - Whole cell lysates from MDA-MB-231 and SUM159 cells were loaded with 50 ug/lane. 10% SDS-PAGE. PGAM5 Antibody (NBP2-93600) was used for primary antibody: 1:1000, 4℃, overnight. Image from a verified customer review.")
![Western Blot Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Western_Blot_6061.jpg)
![Simple Western Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Simple_Western_16632.jpg)
![Knockout Validated Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Knockout_Validated_23684.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0001.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0002.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
