![Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding PEX6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PEX6-Antibody-Immunohistochemistry-Paraffin-NBP1-80955-img0007.jpg "Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding PEX6 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQRLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PEX6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 104 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PEX6 Antibody (NBP1-80955)Find related products by research area.
|
|
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: PEX6 Antibody [NBP1-80955] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/PEX6-Antibody-Western-Blot-NBP1-80955-img0006.jpg "Western Blot: PEX6 Antibody [NBP1-80955] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human tonsil shows moderate to strong cytoplasmic postivity in germinal center cells.](http://images.novusbio.com/fullsize/PEX6-Antibody-Immunohistochemistry-Paraffin-NBP1-80955-img0011.jpg "Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human tonsil shows moderate to strong cytoplasmic postivity in germinal center cells.")
![Western Blot: PEX6 Antibody [NBP1-80955] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/PEX6-Antibody-Western-Blot-NBP1-80955-img0004.jpg "Western Blot: PEX6 Antibody [NBP1-80955] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PEX6-Antibody-Immunohistochemistry-Paraffin-NBP1-80955-img0008.jpg "Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PEX6-Antibody-Immunohistochemistry-Paraffin-NBP1-80955-img0009.jpg "Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PEX6-Antibody-Immunohistochemistry-Paraffin-NBP1-80955-img0010.jpg "Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")