Home » PDK-1 » PDK-1 Proteins » PDK-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PDK-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PDK-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDPK1.

Source: E. coli

Amino Acid Sequence: HSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDPK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48631.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDK-1 Recombinant Protein Antigen

  • 3-phosphoinositide-dependent protein kinase 1
  • 3-phosphoinositide-dependent protein kinase 2 pseudogene
  • PDK1
  • PDK-1
  • PDPK1
  • PDPK2
  • PDPK2P
  • PkB kinase like gene 1
  • PKB kinase

Background

PDK-1 (3-phosphoinositide-dependent protein kinase, gene name PDPK1) is a 58 -68 kDa, 556 amino acid (aa) monomeric protein of the AGC serine/threonine kinase family. It is activated by phosphorylation in the presence of PtdIns(3,4,5) P3 or PtdIns(3,4) P2. Akt, S6 kinases, PKA and PKC-zeta are reported PDK-1 substrates. Through Akt, PDK-1 mediates many of the intracellular actions of insulin. Within the region used as an immunogen, human PDK-1 shares 98% aa identity with mouse and rat PDK-1. One reported isoform has an alternate start site at aa 50, while another lacking aa 238-263 is predicted to be catalytically inactive.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
SGK1 Antibody -
BSA Free
NBP1-76578
Immunocytochemistry/ Immunofluorescence SGK1 Antibody - BSA Free
Western Blot SGK1 Antibody - BSA Free
Immunohistochemistry SGK1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
RSK1 [p Ser380]
Antibody (1024A) [Unc ...
MAB79671
Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
PDK-1 Recombinant
Protein Antigen
NBP2-48631PEP
PDK-1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP) (0)

There are no publications for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP) (0)

There are no reviews for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDK-1 Products

Research Areas for PDK-1 Recombinant Protein Antigen (NBP2-48631PEP)

Find related products by research area.

Blogs on PDK-1

There are no specific blogs for PDK-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDK-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PDPK1