Novus Biologicals products are now on bio-techne.com

PDIA2 Recombinant Protein Antigen

Images

 
There are currently no images for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

PDIA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDIA2.

Source: E. coli

Amino Acid Sequence: LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDIA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49086.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDIA2 Recombinant Protein Antigen

  • Pancreas-specific protein disulfide isomerase
  • pancreatic protein disulfide isomerase
  • PDA2
  • PDI
  • PDIp
  • PDIR
  • protein disulfide isomerase, pancreatic
  • protein disulfide isomerase-associated 2
  • protein disulfide-isomerase A2
  • Rho GDP dissociation inhibitor gamma

Background

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. The protein plays a role in the folding of nascent proteins in the endoplasmic reticulum by forming disulfide bonds through its thiol isomerase, oxidase, and reductase activity. The encoded protein also possesses estradiol-binding activity and can modulate intracellular estradiol levels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB110-40548
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87804
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP2-01652
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP) (0)

There are no publications for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP) (0)

There are no reviews for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDIA2 Products

Research Areas for PDIA2 Recombinant Protein Antigen (NBP2-49086PEP)

Find related products by research area.

Blogs on PDIA2

There are no specific blogs for PDIA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDIA2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA2