![Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83951 (A) shows similar protein distribution across tissues to independent antibody NBP1-83952 (B).](http://images.novusbio.com/fullsize/PCYT2-Antibody-Immunohistochemistry-Paraffin-NBP1-83951-img0013.jpg "Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83951 (A) shows similar protein distribution across tissues to independent antibody NBP1-83952 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PCYT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PCYT2 Antibody (NBP1-83951)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCYT2 |
![Western Blot: PCYT2 Antibody [NBP1-83951] - Analysis using Anti-PCYT2 antibody NBP1-83951 (A) shows similar pattern to independent antibody NBP1-83952 (B).](http://images.novusbio.com/fullsize/PCYT2-Antibody-Western-Blot-NBP1-83951-img0008.jpg "Western Blot: PCYT2 Antibody [NBP1-83951] - Analysis using Anti-PCYT2 antibody NBP1-83951 (A) shows similar pattern to independent antibody NBP1-83952 (B).")
![Immunocytochemistry/Immunofluorescence: PCYT2 Antibody [NBP1-83951] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.](http://images.novusbio.com/fullsize/PCYT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83951-img0006.jpg "Immunocytochemistry/Immunofluorescence: PCYT2 Antibody [NBP1-83951] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.")
![Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PCYT2-Antibody-Immunohistochemistry-Paraffin-NBP1-83951-img0016.jpg "Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/PCYT2-Antibody-Immunohistochemistry-Paraffin-NBP1-83951-img0014.jpg "Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/PCYT2-Antibody-Immunohistochemistry-Paraffin-NBP1-83951-img0015.jpg "Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/PCYT2-Antibody-Immunohistochemistry-Paraffin-NBP1-83951-img0017.jpg "Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.")
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af245_mouse-tsp50-affinity-purified-polyclonal-ab-western-blot-672022104711.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")