PAUF/ZG16B Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZG16B |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry-Paraffin 1:200-1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PAUF/ZG16B Antibody
Background
PAUF (pancreatic adenocarcinoma upregulated factor), gene name ZG16B (zymogen granule protein 16B), is a 156 amino acid, approximately 20-25 kDa secreted protein that is a member of the jacalin-binding lectin family. PAUF expression is thought to be restricted to primates, but the related ZG16P, which shares approximately 25% amino acid sequence identity, is more widely expressed. Human PAUF is overexpressed in pancreatic adenocarcinoma, binds Toll-like receptors TLR2 and TLR4, and inhibits CXCR4-dependent, TLR2-mediated NF-kB activation. It facilitates tumor growth, adhesiveness, and production of pro-tumorigenic cytokines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC
Publications for PAUF/ZG16B Antibody (NBP1-81699) (0)
There are no publications for PAUF/ZG16B Antibody (NBP1-81699).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAUF/ZG16B Antibody (NBP1-81699) (0)
There are no reviews for PAUF/ZG16B Antibody (NBP1-81699).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PAUF/ZG16B Antibody (NBP1-81699) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAUF/ZG16B Products
Blogs on PAUF/ZG16B