Home » PALB2 » PALB2 Antibodies » PALB2 Antibody
Novus Biologicals products are now on bio-techne.com

PALB2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PALB2 Antibody [NBP2-55028] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: PALB2 Antibody [NBP2-55028] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PALB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PALB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PALB2 Antibody

  • DKFZp667I166
  • DKFZp686E1054
  • FANCNFLJ21816
  • partner and localizer of BRCA2
  • PNCA3

Background

PALB2 (partner and localizer of BRCA2) interacts with BRCA2 and promotes BRCA2 localization and stability. PALB2 is also known as FANCN. Bi-allelic mutations in PALB2 result in Fanconi anemia disorder and breast cancer susceptibility. At the cellular level, PALB2 is important to the DNA damage response and chromosome stability and is essential to BRCA2 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
BRIP1/FANCJ
Antibody
NBP1-31883
Immunocytochemistry/ Immunofluorescence BRIP1/FANCJ Antibody
Immunohistochemistry-Paraffin BRIP1/FANCJ Antibody
Western Blot BRIP1/FANCJ Antibody
(7 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
BRCA1 Antibody
(RAY) - BSA Free
NB100-598
Western Blot BRCA1 Antibody (RAY) - BSA Free
Immunocytochemistry/ Immunofluorescence BRCA1 Antibody (RAY) - BSA Free
Flow Cytometry BRCA1 Antibody (RAY) - BSA Free
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
MRPL36 Antibody
NBP1-92139
Immunocytochemistry/ Immunofluorescence MRPL36 Antibody
Immunohistochemistry-Paraffin MRPL36 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western Blot Chk2 [p Thr68] Antibody [Unconjugated]
Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
FACA/FANCA Antibody
NB100-2564
Western Blot FACA/FANCA Antibody
(1 Publication)
Species: Hu
Applications: WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(66 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
BRCC2 Antibody -
BSA Free
NBP2-92672
Western Blot BRCC2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence BRCC2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
FANCD2 Antibody -
BSA Free
NB100-182
Immunocytochemistry/ Immunofluorescence FANCD2 Antibody - BSA Free
Knockdown Validated FANCD2 Antibody - BSA Free
Western Blot FANCD2 Antibody - BSA Free
(8 Reviews)
(229 Publications)
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot LKB1/STK11 Antibody - BSA Free
Immunohistochemistry-Paraffin LKB1/STK11 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence LKB1/STK11 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
BACH1 Antibody
AF5776
Immunohistochemistry BACH1 Antibody
Western Blot BACH1 Antibody
(8 Publications)
Species: Hu
Applications: IHC, WB
Recombinant Human
BJHCC20A GST (N-Term) ...
H00054967-P01
Other Recombinant Human BJHCC20A GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Nbs1 Antibody
NB100-143
Knockout Validated Nbs1 Antibody
Western Blot Nbs1 Antibody
Knockdown Validated Nbs1 Antibody
(8 Reviews)
(204 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Rad50 Antibody
(13B3)
NB100-147
Immunohistochemistry-Paraffin Rad50 Antibody (13B3)
Immunohistochemistry-Paraffin Rad50 Antibody (13B3)
Western Blot Rad50 Antibody (13B3)
(1 Review)
(79 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB

Publications for PALB2 Antibody (NBP2-55028) (0)

There are no publications for PALB2 Antibody (NBP2-55028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PALB2 Antibody (NBP2-55028) (0)

There are no reviews for PALB2 Antibody (NBP2-55028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PALB2 Antibody (NBP2-55028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PALB2 Products

Array NBP2-55028

Research Areas for PALB2 Antibody (NBP2-55028)

Find related products by research area.

Blogs on PALB2.

Check out the latest blog posts on PALB2.
The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PALB2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PALB2