PAIP2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PAIP2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PAIP2 Antibody
Background
PAIP2, also known as Poly(A)-binding protein-interacting protein 2, acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. It displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization. Recombinant PAIP2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
Species: Hu, Po
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, KO, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: IHC
Publications for PAIP2 Antibody (NBP1-80954) (0)
There are no publications for PAIP2 Antibody (NBP1-80954).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAIP2 Antibody (NBP1-80954) (0)
There are no reviews for PAIP2 Antibody (NBP1-80954).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PAIP2 Antibody (NBP1-80954) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAIP2 Products
Blogs on PAIP2