![Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539] - Western blot analysis of extracts of various cell lines, using PABPN1 Rabbit mAb (NBP3-15539) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/PABPN1-Antibody-7V4X8-Western-Blot-NBP3-15539-img0007.jpg "Western Blot: PABPN1 Antibody (7V4X8) [NBP3-15539] - Western blot analysis of extracts of various cell lines, using PABPN1 Rabbit mAb (NBP3-15539) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 7V4X8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (Q86U42). MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | PABPN1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PABPN1 Antibody (NBP3-15539)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PABPN1 |
![Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of C6 cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517361299.jpg "Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of C6 cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517363726.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517344264.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-5220251734522.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517361224.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517333894.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517315578.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-5220251733553.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-5220251733567.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of C2C12 cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517315518.jpg "Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of C2C12 cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517304955.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of U-2 OS cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517333832.jpg "Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of U-2 OS cells using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of paraffin-embedded Human colon cancer using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517352766.jpg "Immunocytochemistry/ Immunofluorescence: PABPN1 Antibody (7V4X8) [PABPN1] - Confocal imaging of paraffin-embedded Human colon cancer using PABPN1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517304927.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-5220251731100.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517311024.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517333865.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-5220251734536.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15539_rabbit-pabpn1-mab-7v4x8-52202517352728.jpg "Immunohistochemistry: PABPN1 Antibody (7V4X8) [PABPN1] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PABPN1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")