![Western Blot: PRMT1 Antibody (10W10U4) [NBP3-16423] - Western blot analysis of extracts of various cell lines, using PRMT1 Rabbit mAb (NBP3-16423) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/PRMT1-Antibody-10W10U4-Western-Blot-NBP3-16423-img0006.jpg "Western Blot: PRMT1 Antibody (10W10U4) [NBP3-16423] - Western blot analysis of extracts of various cell lines, using PRMT1 Rabbit mAb (NBP3-16423) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 10W10U4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT1 (Q99873). MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | PRMT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRMT1 Antibody (NBP3-16423)Find related products by research area.
|
|
PRMT6: One Function, Many Roles Protein arginine methylation is a prevalent posttranslational modification in eukaryotic cells. It regulates RNA processing, trafficking and nascent pre-RNA metabolism, receptor-mediated signal transduction, and transcriptional activation processes. P... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRMT1 |
![Immunocytochemistry/Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of U-2 OS cells using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PRMT1-Antibody-10W10U4-Immunocytochemistry-Immunofluorescence-NBP3-16423-img0005.jpg "Immunocytochemistry/Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of U-2 OS cells using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunohistochemistry of paraffin-embedded human colon using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PRMT1-Antibody-10W10U4-Immunohistochemistry-Paraffin-NBP3-16423-img0002.jpg "Immunohistochemistry-Paraffin: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunohistochemistry of paraffin-embedded human colon using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of C6 cells using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PRMT1-Antibody-10W10U4-Immunocytochemistry-Immunofluorescence-NBP3-16423-img0003.jpg "Immunocytochemistry/Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of C6 cells using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of NIH-3T3 cells using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PRMT1-Antibody-10W10U4-Immunocytochemistry-Immunofluorescence-NBP3-16423-img0004.jpg "Immunocytochemistry/Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of NIH-3T3 cells using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunohistochemistry of paraffin-embedded rat brain using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PRMT1-Antibody-10W10U4-Immunohistochemistry-Paraffin-NBP3-16423-img0001.jpg "Immunohistochemistry-Paraffin: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunohistochemistry of paraffin-embedded rat brain using PRMT1 Rabbit mAb (NBP3-16423) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: PRMT1 Antibody (10W10U4) [NBP3-16423] - Western blot analysis of various lysates using PRMT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-16423_rabbit-prmt1-mab-10w10u4-52202511392227.jpg "Western Blot: PRMT1 Antibody (10W10U4) [NBP3-16423] - Western blot analysis of various lysates using PRMT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.")
![Immunocytochemistry/ Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of U-2 OS cells using PRMT1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16423_rabbit-prmt1-mab-10w10u4-522025125496.jpg "Immunocytochemistry/ Immunofluorescence: PRMT1 Antibody (10W10U4) [NBP3-16423] - Immunofluorescence analysis of U-2 OS cells using PRMT1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: PRMT1 Antibody (10W10U4) [PRMT1] - Immunofluorescence analysis of U-2 OS cells using PRMT1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16423_rabbit-prmt1-mab-10w10u4-52202517202938.jpg "Immunocytochemistry/ Immunofluorescence: PRMT1 Antibody (10W10U4) [PRMT1] - Immunofluorescence analysis of U-2 OS cells using PRMT1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: PRMT1 Antibody (10W10U4) [PRMT1] - Western blot analysis of various lysates using PRMT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-16423_rabbit-prmt1-mab-10w10u4-52202517223990.jpg "Western Blot: PRMT1 Antibody (10W10U4) [PRMT1] - Western blot analysis of various lysates using PRMT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")