![Western Blot: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Western blot analysis of extracts of various cell lines, using p18INK4c/CDKN2C Rabbit mAb (NBP3-16695) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/p18INK4c-CDKN2C-Antibody-1Q10Q4-Western-Blot-NBP3-16695-img0002.jpg "Western Blot: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Western blot analysis of extracts of various cell lines, using p18INK4c/CDKN2C Rabbit mAb (NBP3-16695) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 1Q10Q4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p18INK4c/CDKN2C (P42773). MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CDKN2C |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for p18INK4c/CDKN2C Antibody (NBP3-16695)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDKN2C |
![Immunocytochemistry/Immunofluorescence: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Immunofluorescence analysis of HeLa cells using p18INK4c/CDKN2C Rabbit mAb (NBP3-16695) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/p18INK4c-CDKN2C-Antibody-1Q10Q4-Immunocytochemistry-Immunofluorescence-NBP3-16695-img0001.jpg "Immunocytochemistry/Immunofluorescence: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Immunofluorescence analysis of HeLa cells using p18INK4c/CDKN2C Rabbit mAb (NBP3-16695) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Western blot analysis of extracts from wild type(WT) and CDKN2C knockout (KO) 293T cells, using CDKN2C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-16695_rabbit-p18ink4c-cdkn2c-mab-1q10q4-822025209835.jpg "Western Blot: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Western blot analysis of extracts from wild type(WT) and CDKN2C knockout (KO) 293T cells, using CDKN2C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 180s.")
![Western Blot: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Western blot analysis of extracts of HepG2 cells, using CDKN2C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-16695_rabbit-p18ink4c-cdkn2c-mab-1q10q4-822025208450.jpg "Western Blot: p18INK4c/CDKN2C Antibody (1Q10Q4) [NBP3-16695] - Western blot analysis of extracts of HepG2 cells, using CDKN2C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 180s.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)
![SEC-MALS IL-23A/IL-23 P19 [Unconjugated]](https://images.novusbio.com/images/1290-il_recombinant-human-il-23-protein-sec-mals-1012202411154..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")