Home » ORC3L » ORC3L Proteins » ORC3L Recombinant Protein Antigen

ORC3L Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ORC3L Recombinant Protein Antigen (NBP2-49097PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

ORC3L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ORC3L.

Source: E. coli

Amino Acid Sequence: NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ORC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49097.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ORC3L Recombinant Protein Antigen

  • IMAGE50150
  • LAT
  • LATHEOorigin recognition complex, subunit 3-like (yeast)
  • ORC3Lhomolog of latheo, Drosophila
  • origin recognition complex subunit 3
  • Origin recognition complex subunit Latheo
  • origin recognition complex, subunit 3 (yeast homolog)-like
  • origin recognition complex, subunit 3 honolog (yeast)
  • origin recognition complex, subunit 3 honolog
  • origin recognition complex, subunit 3
  • origin recognition complex, subunit 3-like

Background

ORC3L is involved in DNA replication origin binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZAP70 Antibody -
BSA Free
NBP1-87000
Western Blot ZAP70 Antibody - BSA Free
Immunohistochemistry-Paraffin ZAP70 Antibody - BSA Free
Immunohistochemistry-Paraffin ZAP70 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLP-76/LCP2 [p
Tyr145] Antibody (776 ...
MAB7474
Simple Western SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]
Western Blot SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]
Immunocytochemistry SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]
Species: Hu
Applications: ICC, Simple Western, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
SYK Antibody - BSA
Free
NBP1-32945
Western Blot SYK Antibody - BSA Free
Western Blot SYK Antibody - BSA Free
Immunoprecipitation SYK Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Lck [p Tyr394]
Antibody (755103)
MAB7500
Immunocytochemistry Lck [p Tyr394] Antibody (755103)
Western Blot Lck [p Tyr394] Antibody (755103)
(11 Publications)
Species: Hu
Applications: ICC, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(379 Publications)
Species: Hu
Applications: BA
NTAL Antibody
[Unconjugated]
AF4066
Western Blot NTAL Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(49 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
GRB2 Antibody
[Unconjugated]
AF3846
Western Blot GRB2 Antibody [Unconjugated]
Immunohistochemistry GRB2 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Vav-1 [p Tyr160]
Antibody (751411) [Un ...
MAB37861
Simple Western Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]
Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]
Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(52 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(63 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P

Publications for ORC3L Recombinant Protein Antigen (NBP2-49097PEP) (0)

There are no publications for ORC3L Recombinant Protein Antigen (NBP2-49097PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC3L Recombinant Protein Antigen (NBP2-49097PEP) (0)

There are no reviews for ORC3L Recombinant Protein Antigen (NBP2-49097PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ORC3L Recombinant Protein Antigen (NBP2-49097PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORC3L Products

Blogs on ORC3L

There are no specific blogs for ORC3L, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ORC3L Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ORC3