![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody (CL3770) [NBP2-61636] - Staining of human pancreas shows absence of immunoreactivity (negative control).](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-CL3770-Immunohistochemistry-NBP2-61636-img0002.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody (CL3770) [NBP2-61636] - Staining of human pancreas shows absence of immunoreactivity (negative control).")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clone | CL3770 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| Epitope | EFLNNGEHFVPSAGT |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLCO1B3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P, HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for OATP1B3/SLCO1B3/OATP8 Antibody (NBP2-61636)Find related products by research area.
|
|
OATP8 - A membrane transport protein responsible for cancer drug uptake Human hepatocytes express important transport proteins that are responsible for the uptake and removal of organic anions from the blood. These proteins are members of the organic anion-transporting polypeptide (OATP) family and are essential for pr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLCO1B3 |
![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody (CL3770) [NBP2-61636] - Staining of human liver shows strong membranous immunoreactivity in hepatocytes.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-CL3770-Immunohistochemistry-NBP2-61636-img0001.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody (CL3770) [NBP2-61636] - Staining of human liver shows strong membranous immunoreactivity in hepatocytes.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")