| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NuMA Source: E. coli Amino Acid Sequence: TEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSST Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | NUMA1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54673. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
| Theoretical MW | 31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Western_Blot_5126.jpg)
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
Research Areas for NuMA Recombinant Protein Antigen (NBP2-54673PEP)Find related products by research area.
|
|
NuMA: The Key to Asymmetric Cell Division Nuclear Mitotic Apparatus protein (NuMA) is a cell cycle-related protein that acts as an organizer of the mitotic spindle during mitosis. It may be involved in coordinating the alignment of the mitotic spindle to the cellular polarity axis, which is a... Read full blog post. |
|
Nucleus and Mitotic Apparatus (NuMA) Protein in Cell Cycle Regulation NuMA, the major protein of the "Nucleus and Mitotic Apparatus", is a structural protein in vertebrates involved in cell cycle regulation. It localizes to the nucleus during interphase, and accumulates at the spindle poles during mitosis and NuMA has b... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUMA1 |
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Western_Blot_5229.jpg)
![Simple Western PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Simple_Western_16989.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images/af2944_human-plzf-affinity-purified-polyclonal-ab-41202412394950.jpg)
