Novus Biologicals products are now on bio-techne.com

NFkB p105/p50 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-38305] - Immunofluorescence analysis of NIH/3T3 cells using NFkB p105/p50 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: ...read more
Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-38305] - Immunofluorescence analysis of A-549 cells using NFkB p105/p50 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated ...read more
Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-38305] - Immunofluorescence analysis of U2OS cells using NFkB p105/p50 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated ...read more
Immunohistochemistry: NFkB p105/p50 Antibody [NBP3-38305] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin using NFkB p105/p50 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen ...read more
Immunohistochemistry: NFkB p105/p50 Antibody [NBP3-38305] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using NFkB p105/p50 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen ...read more
Immunohistochemistry: NFkB p105/p50 Antibody [NBP3-38305] - Immunohistochemistry analysis of paraffin-embedded Rat lung using NFkB p105/p50 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval ...read more
Western Blot: NFkB p105/p50 Antibody [NBP3-38305] - Western blot analysis of lysates from Mouse lung, using NFkB p105/p50 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

NFkB p105/p50 Antibody Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 41-365 of human NFkB p105/p50 (NP_001158884.1).

Sequence:
LAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:500
Theoretical MW
105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for NFkB p105/p50 Antibody

  • DKFZp686C01211
  • DNA binding factor KBF1
  • DNA-binding factor KBF1
  • EBP-1
  • KBF1
  • NF-kappaB
  • NF-kappa-B
  • NF-kappabeta
  • NFKB-p105
  • NFKB-p50
  • nuclear factor kappa-B DNA binding subunit
  • nuclear factor NF-kappa-B p105 subunit
  • nuclear factor NF-kappa-B p50 subunit
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151
  • p105
  • p50

Background

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB5526
Species: Hu, Mu
Applications: WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF2699
Species: Mu
Applications: Simple Western, WB
NBP3-38305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for NFkB p105/p50 Antibody (NBP3-38305) (0)

There are no publications for NFkB p105/p50 Antibody (NBP3-38305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFkB p105/p50 Antibody (NBP3-38305) (0)

There are no reviews for NFkB p105/p50 Antibody (NBP3-38305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFkB p105/p50 Antibody (NBP3-38305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFkB p105/p50 Products

Research Areas for NFkB p105/p50 Antibody (NBP3-38305)

Find related products by research area.

Blogs on NFkB p105/p50.

Nuclear Factor kappa B Signaling in the Immune System
Nuclear Factor kappa B (NFkB) binds to the kappa-beta site of the immunoglobulin kappa light chain gene enhancer. Thus NFkB has become one of the widely studied transcription factors in innate and adaptive immune responses. The NFkB family is composed...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFkB p105/p50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB1