NF-L Antibody (CL4729) Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
NEFL |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 2-10 ug/ml
- Immunohistochemistry 1:10000 - 1:20000
- Immunohistochemistry-Paraffin 1:10000 - 1:20000
- Western Blot 1 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for NF-L Antibody (CL4729)
Background
Neurofilaments are 10nm intermediate filament proteins located in vertebrate neurons, which regulate axonal diameter. They are composed predominantly of the three major neurofilament proteins: NF-Light, NF-Medium and NF-Heavy. NF-L is the light or low molecular weight polypeptide, and it runs on SDS-PAGE gels at about 68kDa, with some size variation in across species.
Antibodies to NF-L may be used to identify NF-L in neurons and to study neuronal processes in tissue sections and/or culture. NF-L antibodies can also be used to study microfilament accumulations seen in many neurological diseases, such as Lou Geri's disease or Alzheimer's disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ch, Dr, Eq, Hu, Mu, Po, Rt
Applications: IB, ICC/IF, IHC-FrFl, IHC, KD, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu
Applications: IP, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for NF-L Antibody (NBP2-59061) (0)
There are no publications for NF-L Antibody (NBP2-59061).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NF-L Antibody (NBP2-59061) (0)
There are no reviews for NF-L Antibody (NBP2-59061).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NF-L Antibody (NBP2-59061) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NF-L Products
Research Areas for NF-L Antibody (NBP2-59061)
Find related products by research area.
|
Blogs on NF-L