![Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining in human testis and pancreas tissues using anti-NASP antibody. Corresponding NASP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NASP-Antibody-Immunohistochemistry-Paraffin-NBP2-33928-img0013.jpg "Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining in human testis and pancreas tissues using anti-NASP antibody. Corresponding NASP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSG |
| Predicted Species | Mouse (96%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NASP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NASP Antibody (NBP2-33928)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human liver, lymph node, pancreas and testis using Anti-NASP antibody NBP2-33928 (A) shows similar protein distribution across tissues to independent antibody NBP2-33910 (B).](http://images.novusbio.com/fullsize/NASP-Antibody-Immunohistochemistry-Paraffin-NBP2-33928-img0017.jpg "Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human liver, lymph node, pancreas and testis using Anti-NASP antibody NBP2-33928 (A) shows similar protein distribution across tissues to independent antibody NBP2-33910 (B).")
![Western Blot: NASP Antibody [NBP2-33928] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-NASP antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/NASP-Antibody-Western-Blot-NBP2-33928-img0015.jpg "Western Blot: NASP Antibody [NBP2-33928] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-NASP antibody. Remaining relative intensity is presented.")
![Western Blot: NASP Antibody [NBP2-33928] - Analysis in control (vector only transfected HEK293T lysate) and NASP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/NASP-Antibody-Western-Blot-NBP2-33928-img0016.jpg "Western Blot: NASP Antibody [NBP2-33928] - Analysis in control (vector only transfected HEK293T lysate) and NASP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: NASP Antibody [NBP2-33928] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/NASP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33928-img0014.jpg "Immunocytochemistry/Immunofluorescence: NASP Antibody [NBP2-33928] - Staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human lymph node.](http://images.novusbio.com/fullsize/NASP-Antibody-Immunohistochemistry-Paraffin-NBP2-33928-img0019.jpg "Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/NASP-Antibody-Immunohistochemistry-Paraffin-NBP2-33928-img0011.jpg "Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/NASP-Antibody-Immunohistochemistry-Paraffin-NBP2-33928-img0012.jpg "Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human liver.](http://images.novusbio.com/fullsize/NASP-Antibody-Immunohistochemistry-Paraffin-NBP2-33928-img0018.jpg "Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining of human liver.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")