Home » Myosin heavy chain 14 » Myosin heavy chain 14 Proteins » Myosin heavy chain 14 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Myosin heavy chain 14 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Myosin heavy chain 14 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin Heavy Chain.

Source: E. coli

Amino Acid Sequence: GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYH14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49626.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin heavy chain 14 Recombinant Protein Antigen

  • DFNA4
  • DFNA4A
  • FP17425
  • MHC16
  • MYH14
  • MYH17
  • myosin, heavy chain 14, non-muscle
  • NMHC II-C
  • NMHC-II-C
  • PNMHH

Background

The MYH14 gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-14 (MYO14). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene result in one form of autosomal dominant hearing impairment. Multiple transcript variants encoding different isoforms have been found for this gene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rpn2 Antibody
NBP2-38323
Immunocytochemistry/ Immunofluorescence Rpn2 Antibody
Immunohistochemistry-Paraffin Rpn2 Antibody
Immunohistochemistry-Paraffin Rpn2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Desmin Antibody
[Unconjugated]
AF3844
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: IHC
Titin Antibody
NBP1-88071
Immunohistochemistry-Paraffin Titin Antibody
Immunohistochemistry-Paraffin Titin Antibody
Immunohistochemistry-Paraffin Titin Antibody
(4 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Caldesmon/CALD1
Antibody (h-CALD)
NBP2-44421
Immunohistochemistry-Paraffin Caldesmon/CALD1 Antibody (h-CALD)
Western Blot Caldesmon/CALD1 Antibody (h-CALD)
Simple Western Caldesmon/CALD1 Antibody (h-CALD)
(1 Review)
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Recombinant Human
IGKV1-5 GST (N-Term) ...
H00028299-P01
Other Recombinant Human IGKV1-5 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Applications: Secondary
Myosin light chain
kinase Antibody (SU40 ...
NBP2-67486
Flow Cytometry Myosin light chain kinase Antibody (SU40-06)
Immunocytochemistry/ Immunofluorescence Myosin light chain kinase Antibody (SU40-06)
Immunocytochemistry/ Immunofluorescence Myosin light chain kinase Antibody (SU40-06)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Sodium Potassium
ATPase Beta 1 Antibod ...
NB300-147
Western Blot Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Western Blot Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
(16 Publications)
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC, IHC-P, WB
MLC1 Antibody
NBP1-81555
Western Blot MLC1 Antibody
Immunohistochemistry-Paraffin MLC1 Antibody
Immunohistochemistry-Paraffin MLC1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
MYLK3 Antibody
NBP2-62682
Immunohistochemistry-Paraffin MYLK3 Antibody
Immunohistochemistry-Paraffin MYLK3 Antibody
Immunohistochemistry-Paraffin MYLK3 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP) (0)

There are no publications for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP) (0)

There are no reviews for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin heavy chain 14 Products

Research Areas for Myosin Heavy Chain Recombinant Protein Antigen (NBP2-49626PEP)

Find related products by research area.

Blogs on Myosin heavy chain 14

There are no specific blogs for Myosin heavy chain 14, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody
NB300-223

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin heavy chain 14 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MYH14