Novus Biologicals products are now on bio-techne.com

Musculin Recombinant Protein Antigen

Images

 
There are currently no images for Musculin Recombinant Protein Antigen (NBP2-56244PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Musculin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Musculin.

Source: E. coli

Amino Acid Sequence: TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MSC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56244.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Musculin Recombinant Protein Antigen

  • ABF1
  • ABF-1activated B-cell factor 1, homolog of mouse musculin
  • Activated B-cell factor 1
  • BHLHA22
  • bHLHa22activated B-cell factor-1
  • Class A basic helix-loop-helix protein 22
  • musculin (activated B-cell factor-1)
  • musculin
  • MYOR

Background

Differentiation of myogenic cells is regulated by multiple positively and negatively acting factors. One well characterized family of helix-loop-helix (HLH) proteins, known to play an important role in the regulation of muscle cell development, includes MyoD, myogenin and musculin (also designated MyoR). Members of this group of transcription factors form heterodimers with products of a more widely expressed family of bHLH genes, the E family, which consists of at least three distinct genes: E2A, IF2 and HEB. MyoD-E or musculin-E heterodimers bind avidly to consensus E box motifs, which are functionally important elements in the promoter regions of many musclespecific terminal differentiation genes. MyoD complexes potently induce transcriptional activation, while musculin complexes bind adjacent to MyoD DNA-binding regions to represses MyoD activity, which then results in the delayed expression of muscle-specific genes. Musculin is highly expressed in undifferentiated and proliferating myoblasts in culture, and its expression is down regulated during myogenesis and at the onset of terminal differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
AF4117
Species: Rt
Applications: IHC, WB
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
AF2067
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
233-FB
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
294-HG
Species: Hu
Applications: BA
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
355-BM
Species: Hu, Mu, Rt
Applications: BA
DCC270
Species: Hu
Applications: ELISA
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB

Publications for Musculin Recombinant Protein Antigen (NBP2-56244PEP) (0)

There are no publications for Musculin Recombinant Protein Antigen (NBP2-56244PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Musculin Recombinant Protein Antigen (NBP2-56244PEP) (0)

There are no reviews for Musculin Recombinant Protein Antigen (NBP2-56244PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Musculin Recombinant Protein Antigen (NBP2-56244PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Musculin Products

Blogs on Musculin

There are no specific blogs for Musculin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Musculin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MSC