Home » MTAP » MTAP Proteins » MTAP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MTAP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MTAP Recombinant Protein Antigen (NBP2-56796PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MTAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTAP.

Source: E. coli

Amino Acid Sequence: IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56796.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTAP Recombinant Protein Antigen

  • 5'-methylthioadenosine phosphorylase
  • BDMF
  • C86fus
  • DMSFH
  • DMSMFH
  • EC 2.4.2.28
  • HEL-249
  • LGMBF
  • methylthioadenosine phosphorylase
  • MSAPMeSAdo phosphorylase
  • MTA phosphorylase
  • MTAP
  • MTAPase
  • S-methyl-5'-thioadenosine phosphorylase

Background

MTAP encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Purine Nucleoside
Phosphorylase/PNP Ant ...
NBP1-82541
Western Blot Purine Nucleoside Phosphorylase/PNP Antibody
Immunohistochemistry-Paraffin Purine Nucleoside Phosphorylase/PNP Antibody
Immunohistochemistry-Paraffin Purine Nucleoside Phosphorylase/PNP Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot NXT1 Antibody (4F11)
Immunocytochemistry/ Immunofluorescence NXT1 Antibody (4F11)
Western Blot NXT1 Antibody (4F11)
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
MRPL28 Antibody
NBP3-38209
Immunocytochemistry/ Immunofluorescence MRPL28 Antibody
Immunoprecipitation MRPL28 Antibody
Immunohistochemistry MRPL28 Antibody
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
APRT Antibody
NBP1-89519
Immunohistochemistry-Paraffin APRT Antibody
Immunocytochemistry/ Immunofluorescence APRT Antibody
Western Blot APRT Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
CDK2 Antibody
(OTI2D9)
NBP2-00776
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Immunohistochemistry-Paraffin Ornithine Decarboxylase Antibody (ODC1/485)
Immunocytochemistry/ Immunofluorescence Ornithine Decarboxylase Antibody (ODC1/485)
Western Blot Ornithine Decarboxylase Antibody (ODC1/485)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IFN-beta
[Unconjugated]
8499-IF
Binding Activity IFN-beta [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
ADK Antibody
NBP2-15291
Immunohistochemistry-Paraffin ADK Antibody
Western Blot ADK Antibody
Western Blot ADK Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IFN-alpha I/IFNA17
Antibody
H00003451-D01P
Immunocytochemistry/ Immunofluorescence IFN-alpha I/IFNA17 Antibody
Western Blot IFN-alpha I/IFNA17 Antibody
Western Blot IFN-alpha I/IFNA17 Antibody
Species: Hu, Rt
Applications: ICC/IF, WB

Publications for MTAP Recombinant Protein Antigen (NBP2-56796PEP) (0)

There are no publications for MTAP Recombinant Protein Antigen (NBP2-56796PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTAP Recombinant Protein Antigen (NBP2-56796PEP) (0)

There are no reviews for MTAP Recombinant Protein Antigen (NBP2-56796PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTAP Recombinant Protein Antigen (NBP2-56796PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTAP Products

Blogs on MTAP

There are no specific blogs for MTAP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTAP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MTAP