Home » MRPL28 » MRPL28 Proteins » MRPL28 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MRPL28 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MRPL28 Protein (NBP2-38760PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MRPL28 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPL28.

Source: E. coli

Amino Acid Sequence: PVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANND

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRPL28
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38760.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPL28 Recombinant Protein Antigen

  • L28mt
  • MAAT139S ribosomal protein L28, mitochondrial
  • Melanoma antigen p15
  • melanoma-associated antigen recognised by cytotoxic T lymphocytes
  • Melanoma-associated antigen recognized by T lymphocytes
  • MGC8499
  • mitochondrial ribosomal protein L28
  • MRP-L28
  • p15

Background

MRPL28, also known as 39 S ribosomal protein L28, mitochondrial, is a 30.2 kDa, 256 amino acid protein that is utilized in mitochondrial ribosomes as a member of the ribosomal protein L28P family. Diseases and disorders such as hepatitis, leukemia, bronchitis, inflammatory bowel disease, melanoma, vaccinia, influenza, esophagitis, hepatocellular carcinoma, Hodgkin's lymphoma, and rheumatoid arthritis are beings studied with this protein. The protein interacts with ENSG00000258947, TUBB4A, OXA1L, ICT1, and TUBB3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
S100A10 Antibody
[Unconjugated]
AF2377
Western Blot S100A10 Antibody [Unconjugated]
Immunohistochemistry S100A10 Antibody [Unconjugated]
Simple Western S100A10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
TMED7 Antibody
NBP1-90949
Immunohistochemistry TMED7 Antibody
Immunohistochemistry TMED7 Antibody
Immunohistochemistry TMED7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Dynactin 6 Antibody
NBP1-80616
Immunohistochemistry-Paraffin Dynactin 6 Antibody
Western Blot Dynactin 6 Antibody
Western Blot Dynactin 6 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SSSCA1 Antibody
(OTI2F5)
NBP2-03198
Flow Cytometry SSSCA1 Antibody (OTI2F5)
Flow Cytometry SSSCA1 Antibody (OTI2F5)
Flow Cytometry SSSCA1 Antibody (OTI2F5)
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IFI27 Antibody
(CL14627)
NBP3-26876
Immunohistochemistry-Paraffin IFI27 Antibody (CL14627)
Immunohistochemistry-Paraffin IFI27 Antibody (CL14627)
Immunohistochemistry-Paraffin IFI27 Antibody (CL14627)
Species: Hu
Applications: IHC
26S proteasome
subunit 9 Antibody
NBP2-47560
Immunohistochemistry 26S proteasome subunit 9 Antibody
Immunohistochemistry-Paraffin 26S proteasome subunit 9 Antibody
Immunohistochemistry-Paraffin 26S proteasome subunit 9 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
SF3B14 Antibody
NBP1-87431
Immunocytochemistry/ Immunofluorescence SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RPP14 Antibody
NBP1-80965
Western Blot RPP14 Antibody
Immunocytochemistry/ Immunofluorescence RPP14 Antibody
Immunohistochemistry-Paraffin RPP14 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CDK2AP2 Antibody
H00010263-B01P
Western Blot CDK2AP2 Antibody
Western Blot CDK2AP2 Antibody
Western Blot CDK2AP2 Antibody
Species: Hu, Mu, Rt
Applications: WB
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/ Immunofluorescence ROBLD3 Antibody
Immunohistochemistry ROBLD3 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for MRPL28 Protein (NBP2-38760PEP) (0)

There are no publications for MRPL28 Protein (NBP2-38760PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL28 Protein (NBP2-38760PEP) (0)

There are no reviews for MRPL28 Protein (NBP2-38760PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRPL28 Protein (NBP2-38760PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPL28 Products

Research Areas for MRPL28 Protein (NBP2-38760PEP)

Find related products by research area.

Blogs on MRPL28

There are no specific blogs for MRPL28, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRPL28 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MRPL28