![Immunocytochemistry/Immunofluorescence: MOX1 Antibody (4E10) [H00004222-M27] - Analysis of monoclonal antibody to MEOX1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/MOX1-Antibody-4E10-Immunocytochemistry-Immunofluorescence-H00004222-M27-img0001.jpg "Immunocytochemistry/Immunofluorescence: MOX1 Antibody (4E10) [H00004222-M27] - Analysis of monoclonal antibody to MEOX1 on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4E10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MEOX1 (NP_004518, 82 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK* |
| Specificity | MEOX1 (4E10) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MEOX1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry CD200/OX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD200_AF2724_Immunohistochemistry_11377.jpg)
![Simple Western CD200/OX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD200_AF2724_Simple_Western_18956.jpg)
![Western Blot CD200/OX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD200_AF2724_Western_Blot_20557.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images2/Pax3_MAB2457_Immunocytochemistry__Immunofluorescence_20313.jpg)
![Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images/mab2457_human-mouse-pax3-pax7-mab-clone-274212-41202412512639.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![SEC-MALS IL-23A/IL-23 P19 [Unconjugated]](https://images.novusbio.com/images/1290-il_recombinant-human-il-23-protein-sec-mals-1012202411154..jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
