Home » MED28 » MED28 Proteins » MED28 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MED28 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MED28 Protein (NBP2-38271PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MED28 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED28.

Source: E. coli

Amino Acid Sequence: PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED28
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38271.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED28 Recombinant Protein Antigen

  • DKFZP434N185
  • EG1DKFZp434N185
  • magicin
  • mediator complex subunit 281500003D12Rik
  • mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae)
  • subunit 28 homolog

Background

MED28 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatoryproteins to the basal RNA polymerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RNASE3 Antibody
NBP2-33778
Western Blot RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EPX Antibody
(rEPO104)
NBP3-07388
Immunohistochemistry-Paraffin EPX Antibody (rEPO104)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NF2/Merlin Antibody
NBP1-87757
Immunocytochemistry/ Immunofluorescence NF2/Merlin Antibody
Immunohistochemistry-Paraffin NF2/Merlin Antibody
Immunohistochemistry-Paraffin NF2/Merlin Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
CDK2 Antibody
(OTI2D9)
NBP2-00776
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(44 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(840 Publications)
Species: Hu
Applications: BA
TIMP-1 [HRP]
DTM100
N/A TIMP-1 [HRP]
N/A TIMP-1 [HRP]
(97 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
Endoglycan/PODXL2
Antibody
AF3534
Immunohistochemistry Endoglycan/PODXL2 Antibody
(3 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
Eosinophil derived
neurotoxin Antibody - ...
NBP3-03635
Western Blot Eosinophil derived neurotoxin Antibody - BSA Free
Immunohistochemistry Eosinophil derived neurotoxin Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
GRB2 Antibody
[Unconjugated]
AF3846
Western Blot GRB2 Antibody [Unconjugated]
Immunohistochemistry GRB2 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for MED28 Protein (NBP2-38271PEP) (0)

There are no publications for MED28 Protein (NBP2-38271PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED28 Protein (NBP2-38271PEP) (0)

There are no reviews for MED28 Protein (NBP2-38271PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED28 Protein (NBP2-38271PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED28 Products

Blogs on MED28

There are no specific blogs for MED28, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED28 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MED28