![Western Blot: Eosinophil derived neurotoxin Antibody [NBP3-03635] - Analysis of extracts of various cell lines, using Eosinophil derived neurotoxin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Eosinophil-derived-neurotoxin-Antibody-Western-Blot-NBP3-03635-img0001.jpg "Western Blot: Eosinophil derived neurotoxin Antibody [NBP3-03635] - Analysis of extracts of various cell lines, using Eosinophil derived neurotoxin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-161 of human Eosinophil derived neurotoxin (NP_002925.1). KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNASE2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Western_Blot_5321.jpg)
![Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Simple_Western_16637.jpg)
![Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Immunocytochemistry__Immunofluorescence_17390.jpg)
| Publication using NBP3-03635 | Applications | Species |
|---|---|---|
| Meng Z, Zhang S, Li W et al. Cationic proteins from eosinophils bind bone morphogenetic protein receptors promoting vascular calcification and atherogenesis European heart journal 2023-06-03 [PMID: 37279475] (IP, Mouse, Human) | IP | Mouse, Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Eosinophil derived neurotoxin Antibody (NBP3-03635)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNASE2 |
![Immunohistochemistry: Eosinophil derived neurotoxin Antibody [NBP3-03635] - Immunofluorescence analysis of mouse spleen using Eosinophil derived neurotoxin Rabbit pAb (NBP3-03635) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Eosinophil-derived-neurotoxin-Antibody-Immunohistochemistry-NBP3-03635-img0002.jpg "Immunohistochemistry: Eosinophil derived neurotoxin Antibody [NBP3-03635] - Immunofluorescence analysis of mouse spleen using Eosinophil derived neurotoxin Rabbit pAb (NBP3-03635) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A CCL11/Eotaxin [HRP]](https://images.novusbio.com/images2/CCL11_MME00_ELISA_294.jpg)
![N/A CCL11/Eotaxin [HRP]](https://images.novusbio.com/images2/DATA_CCL11_MME00_ELISA_1002.jpg)
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![SEC-MALS IL-3 [Unconjugated]](https://images.novusbio.com/images/203-il_recombinant-human-il-3-protein-sec-mals-133202482656..jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")