Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, IHC |
Clone | 1B11 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | MECP2 (AAH11612, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ |
Marker | Nucleus Marker |
Specificity | MECP2 (1B11) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | MECP2 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
||
Control |
|
||
Reviewed Applications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | IgG purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
IHC-P | Human | 11/22/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MeCP2 Antibody (H00004204-M03)Find related products by research area.
|
New MECP2 Study Suggests Important Link to GABA MECP2 antibodies are used in DNA methylation studies as well as research into Rett syndrome, a progressive neurological disorder caused by a mutation in the MECP2 gene. Now, a new study has been published by the laboratory where the Rett Syndrome gene... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.