![Western Blot: MCT1/SLC16A1 Antibody [NBP1-59879] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/MCT1-SLC16A1-Antibody-Western-Blot-NBP1-59879-img0002.jpg "Western Blot: MCT1/SLC16A1 Antibody [NBP1-59879] - HT1080 cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC16A1(solute carrier family 16, member 1 (monocarboxylic acid transporter 1)) The peptide sequence was selected from the middle region of SLC16A1.
Peptide sequence EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC16A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MCT1/SLC16A1 Antibody (NBP1-59879)Find related products by research area.
|
|
Monocarboxylate Transporter 1 (MCT1) - a novel oncogene MCT1 is a proton-linked transport carrier that catalyzes the movement of short chain monocarboxylates (branched-chain oxo acids derived from leucine, valine, and isoleucine) across both plasma and inner mitochondrial membranes. In particular, subst... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-59879] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Membrane and cytoplasmic; Primary Antibody Concentration: 1:100](http://images.novusbio.com/fullsize/MCT1-SLC16A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59879-img0003.jpg "Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-59879] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Membrane and cytoplasmic; Primary Antibody Concentration: 1:100")
![Western Blot EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Western_Blot_16707.jpg)
![Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Immunohistochemistry_17212.jpg)
![Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Knockout_Validated_22526.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")