Home » MAP4K2 » MAP4K2 Proteins » MAP4K2 Recombinant Protein Antigen

MAP4K2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MAP4K2 Protein (NBP1-88584PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

MAP4K2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP4K2.

Source: E. coli

Amino Acid Sequence: ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP4K2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88584.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP4K2 Recombinant Protein Antigen

  • B lymphocyte serine/threonine protein kinase
  • B lymphocyte serine/threonine-protein kinase
  • BL44
  • EC 2.7.11
  • EC 2.7.11.1
  • GC kinase
  • GCKMEK kinase kinase 2
  • Germinal center kinase
  • germinal centre kinase (GC kinase)
  • MAP4K2
  • MAPK/ERK kinase kinase kinase 2
  • MEK kinase kinase 2
  • MEKKK 2
  • mitogen-activated protein kinase kinase kinase kinase 2
  • Rab8 interacting protein
  • Rab8-interacting protein
  • RAB8IP
  • RAB8IPMEKKK 2

Background

MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. MAP4K2 can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Western Blot HNF-4 alpha/NR2A1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Immunoprecipitation HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Kir6.2 Antibody
NBP2-76944
Western Blot Kir6.2 Antibody
Immunocytochemistry/ Immunofluorescence Kir6.2 Antibody
Immunohistochemistry Kir6.2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SUR1 Antibody
(S289-16)
NBP2-59320
Western Blot SUR1 Antibody (S289-16)
Immunocytochemistry/ Immunofluorescence SUR1 Antibody (S289-16)
Western Blot SUR1 Antibody (S289-16)
(2 Reviews)
(4 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
GCKR Antibody
(OTI1E7)
NBP2-03396
Western Blot GCKR Antibody (OTI1E7)
Immunohistochemistry-Paraffin GCKR Antibody (OTI1E7)
Immunohistochemistry-Paraffin GCKR Antibody (OTI1E7)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/ Immunofluorescence TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Glut2 Antibody -
BSA Free
NBP2-22218
Western Blot Glut2 Antibody - BSA Free
Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free
Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free
(2 Reviews)
(15 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western Blot PDX-1/IPF1 Antibody [Unconjugated]
Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]
Simple Western PDX-1/IPF1 Antibody [Unconjugated]
(74 Publications)
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
MAP4K5 Antibody
NBP1-31234
Immunoprecipitation MAP4K5 Antibody
Immunocytochemistry/ Immunofluorescence MAP4K5 Antibody
Immunohistochemistry-Paraffin MAP4K5 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Melatonin Receptor
1B Antibody - BSA Fre ...
NLS932
Immunohistochemistry-Paraffin Melatonin Receptor 1B Antibody - BSA Free
Western Blot Melatonin Receptor 1B Antibody - BSA Free
Immunohistochemistry Melatonin Receptor 1B Antibody - BSA Free
(1 Review)
(13 Publications)
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
G6PC2 Antibody
NBP3-12306
Immunohistochemistry-Paraffin G6PC2 Antibody
Immunohistochemistry-Paraffin G6PC2 Antibody
Western Blot G6PC2 Antibody
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
G6PC Antibody
NBP1-80533
Western Blot G6PC Antibody
Western Blot G6PC Antibody
Western Blot G6PC Antibody
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: WB
Glutamate
Dehydrogenase Antibod
NBP2-16679
Western Blot Glutamate Dehydrogenase Antibody
Immunocytochemistry/ Immunofluorescence Glutamate Dehydrogenase Antibody
Immunohistochemistry-Paraffin Glutamate Dehydrogenase Antibody
(4 Publications)
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MST3 Antibody
NBP1-87833
Western Blot MST3 Antibody
Immunocytochemistry/ Immunofluorescence MST3 Antibody
Immunohistochemistry-Paraffin MST3 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NeuroD1 Antibody
[Unconjugated]
AF2746
Immunocytochemistry NeuroD1 Antibody [Unconjugated]
(18 Publications)
Species: Hu, Mu
Applications: ICC, WB
MAP4K2 Recombinant
Protein Antigen
NBP1-88584PEP
MAP4K2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MAP4K2 Protein (NBP1-88584PEP) (0)

There are no publications for MAP4K2 Protein (NBP1-88584PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K2 Protein (NBP1-88584PEP) (0)

There are no reviews for MAP4K2 Protein (NBP1-88584PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP4K2 Protein (NBP1-88584PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP4K2 Products

Research Areas for MAP4K2 Protein (NBP1-88584PEP)

Find related products by research area.

Blogs on MAP4K2

There are no specific blogs for MAP4K2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAP4K2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP4K2