M-Cadherin/Cadherin-15 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human M-Cadherin/Cadherin-15. Source: E. coli Amino Acid Sequence: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
CDH15 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57991. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for M-Cadherin/Cadherin-15 Recombinant Protein Antigen
Background
Cadherins are a multigene family of Ca++-dependent cell adhesion molecules. They are transmembrane glycoproteins consisting of an extracellular domain, which mediates Ca++-dependent intercellular adhesion by homophilic interactions, a transmembrane region and a cytoplasmic domain. The extracellular domain is divided into a series of subdomains designated EC1-EC5. Homolgies between different members of the cadherin family are most prominent in the cytoplasmic domain and in EC1 and EC2 and much less so in EC5 of the extracellular domain and in the transmembrane region. The binding properties and specificities of the adhesive function are located in the N-terminal part of the molecules. Four members of the cadherin family have been identified and molecularly cloned from mammalian cells. These include the neuronal (N), epithelial (E), placental (P) and muscle (M) cadherins. M-cadherin is not found in fibroblasts but is expressed at low level in myoblasts and is upregulated following induction of myotube formation, suggesting a specific function in skeletal muscle cell differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Mu
Applications: AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP) (0)
There are no publications for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP) (0)
There are no reviews for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP) (0)
Additional M-Cadherin/Cadherin-15 Products
Blogs on M-Cadherin/Cadherin-15