Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human LTC4S (NP_665874.1). YRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | LTC4S |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS with 50% glycerol, pH7.3. |
Preservative | 0.01% Thimerosal |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LTC4S Antibody (NBP3-03949)Find related products by research area.
|
Antibody treatment can generate microglia-like cells from bone marrow By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | LTC4S |