![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining in human kidney and lymph node tissues using anti-ATP6V0A4 antibody. Corresponding ATP6V0A4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0007.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining in human kidney and lymph node tissues using anti-ATP6V0A4 antibody. Corresponding ATP6V0A4 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP6V0A4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ATP6V0A4 Antibody (NBP1-89330)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP6V0A4 |
![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex, colon, kidney and liver using Anti-ATP6V0A4 antibody NBP1-89330 (A) shows similar protein distribution across tissues to independent antibody NBP2-39030 (B).](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0008.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex, colon, kidney and liver using Anti-ATP6V0A4 antibody NBP1-89330 (A) shows similar protein distribution across tissues to independent antibody NBP2-39030 (B).")
![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human colon.](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0011.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0005.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0006.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0009.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human liver.](http://images.novusbio.com/fullsize/ATP6V0A4-Antibody-Immunohistochemistry-Paraffin-NBP1-89330-img0010.jpg "Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human liver.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")