Novus Biologicals products are now on bio-techne.com

LRSAM1 Recombinant Protein Antigen

Name: LRSAM1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-82016PEP
Price: 279 USD

Images

There are currently no images for LRSAM1 Protein (NBP1-82016PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LRSAM1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRSAM1. Source: E. coli Amino Acid Sequence: REILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	LRSAM1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82016. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LRSAM1 Recombinant Protein Antigen

EC 6.3.2.-
FLJ31641
hTAL
leucine rich repeat and sterile alpha motif containing 1
Leucine-rich repeat and sterile alpha motif-containing protein 1
RIFLE
TALE3 ubiquitin-protein ligase LRSAM1
Tsg101-associated ligase

Background

LRSAM1 is a multifunctional RING finger protein that selectively regulates cell adhesion molecules, has ubiquitin ligase activity, and plays a role in receptor endocytosis and viral budding (Li et al., 2003 [PubMed 14635195]; Amit et al., 2004 [PubMed 15256501]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NKCC2/SLC12A1
Antibody

NBP1-80993

Immunohistochemistry-Paraffin NKCC2/SLC12A1 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Uromodulin
Antibody [Unconjugate

AF5175

Immunohistochemistry Uromodulin Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]

(8 Publications)

Species: Mu

Applications: IHC, Simple Western, WB

Neurophysin
II/Arg-vasopressin An ...

AF009

Species: Hu

Applications: IHC, WB

Lipocalin-2/NGAL
[Biotin]

DY1857

(133 Publications)

Species: Mu

Applications: ELISA

Transaldolase 1
Antibody

NBP1-88109

Immunocytochemistry/ Immunofluorescence Transaldolase 1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

KCNJ1 Antibody

NBP1-82874

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P

TRP2 Antibody

NBP1-86893

(1 Review)

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

SCL/Tal1 Antibody
(OTI5H1)

NBP2-01488

Flow Cytometry SCL/Tal1 Antibody (OTI5H1)

Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

EGF [Unconjugated]

236-EG

(843 Publications)

Species: Hu

Applications: BA

IL-2 [Unconjugated]

202-IL

(4 Reviews)

(377 Publications)

Species: Hu

Applications: BA

RAPGEF5 Antibody

NBP2-57362

Immunocytochemistry/ Immunofluorescence RAPGEF5 Antibody

Species: Hu

Applications: ICC/IF, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(817 Publications)

Species: Hu

Applications: BA

IFN-alpha/beta R1
Antibody [Unconjugate ...

AF245

(9 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, WB

Cystatin C [HRP]

MSCTC0

(35 Publications)

Species: Mu, Rt

Applications: ELISA

RUNX2/CBFA1
Antibody (232902) [Un ...

MAB2006

(1 Review)

(28 Publications)

Species: Hu

Applications: ICC

NLRP3/NALP3
Antibody - BSA Free

NBP2-12446

(4 Reviews)

(234 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB

Serpin
A8/Angiotensinogen An ...

NBP1-30027

Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

SCLY Antibody

NBP2-48693

Immunocytochemistry/ Immunofluorescence SCLY Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Publications for LRSAM1 Protein (NBP1-82016PEP) (0)

There are no publications for LRSAM1 Protein (NBP1-82016PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRSAM1 Protein (NBP1-82016PEP) (0)

There are no reviews for LRSAM1 Protein (NBP1-82016PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRSAM1 Protein (NBP1-82016PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRSAM1 Products

Research Areas for LRSAM1 Protein (NBP1-82016PEP)

Find related products by research area.

Lipid and Metabolism

Blogs on LRSAM1

There are no specific blogs for LRSAM1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our LRSAM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

LRSAM1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

LRSAM1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

LRSAM1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for LRSAM1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for LRSAM1 Protein (NBP1-82016PEP) (0)

Reviews for LRSAM1 Protein (NBP1-82016PEP) (0)

FAQs for LRSAM1 Protein (NBP1-82016PEP) (0)

Additional LRSAM1 Products

Research Areas for LRSAM1 Protein (NBP1-82016PEP)

Blogs on LRSAM1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics