Orthogonal Strategies: Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Analysis in human lymph node and skeletal muscle tissues. Corresponding LBR RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human testis shows strong positivity in nuclear membrane in subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human lymph node shows moderate to strong positivity in nuclear membrane.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human small intestine shows strong positivity in nuclear membrane in glandular cells.
This antibody was developed against a recombinant protein corresponding to the amino acids: MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS
Marker
Nuclear Inner Membrane Marke
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LBR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%) Use in Mouse reported in scientific literature (PMID:33846535).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Lamin B Receptor Antibody - BSA Free
DHCR14B
FLJ43126
Integral nuclear envelope inner membrane protein
lamin B receptor
lamin-B receptor
LMN2R
MGC9041
PHA
Background
Lamins are nuclear membrane proteins that serve to maintain specific cellular functions, such as DNA replication and chromatin organization (1). Lamin B receptor (LBR) is an integral protein of the nuclear envelope inner membrane. It is phosphorylated by CDC2 protein kinase in mitosis when the inner nuclear membrane breaks down into vesicles that dissociate from the lamina and the chromatin. It is phosphorylated by different protein kinases in interphase when the membrane is associated with these structures (2). The cleavage of lamins results in nuclear disregulation and cell death (3,4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Lamin B Receptor Antibody (NBP2-14185) (0)
There are no reviews for Lamin B Receptor Antibody (NBP2-14185).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Lamin B Receptor Antibody - BSA Free and receive a gift card or discount.