Lactoferrin Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LTF |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Lactoferrin Antibody
Background
Lactoferrin is an iron binding glycoprotein with an approximate molecular weight of 80 kDa. The protein has two iron binding domains each housing one Fe3+ and the synergistic CO32- ion. The crystal structure form of human lactoferrin at 2.2A resolution exhibits 5330 protein atoms, 2Fe2+, 2CO32- and 98 carbohydrate atoms. Lactoferrin is absorbed from intestine by apical side of the membrane and localized to the nuclei. Intravenous infusion of lactoferrin is protective against lethal doses of E coli and induce bacterimia by a mechanism that downregulates neutrophil TNF alfa secretion. Recombinant human lactoferrin (rhLF), expressed and extracted from rice seed, is being evaluated for use as a dietary supplement to treat iron deficiency and/or iron deficiency induced anemia. Lactoferrin has been shown to have a role in the immune system and in early development of the embryo. A specific receptor for lactoferrin binding has been implicated in the human fetal intestine. Early embryonic localisation of lactoferrin by IHC has suggested its presence in various tissues including intestinal epitheliuem, kiney, and various regions of the brain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: PAGE
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: IHC
Publications for Lactoferrin Antibody (NBP2-38885) (0)
There are no publications for Lactoferrin Antibody (NBP2-38885).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lactoferrin Antibody (NBP2-38885) (0)
There are no reviews for Lactoferrin Antibody (NBP2-38885).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Lactoferrin Antibody (NBP2-38885) (0)