Home » KAT3B/p300 » KAT3B/p300 Proteins » Recombinant Human KAT3B/p300 GST (N-Term) Protein

Recombinant Human KAT3B/p300 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human KAT3B/p300 Protein [H00002033-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human KAT3B/p300 Protein [H00002033-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human KAT3B/p300 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 731-830 of Human KAT3B/p300

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
EP300
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KAT3B/p300 GST (N-Term) Protein

  • E1A binding protein p300
  • E1A-associated protein p300
  • E1A-binding protein, 300kD
  • EC 2.3.1
  • EC 2.3.1.48
  • EP300
  • histone acetyltransferase p300
  • KAT3B
  • p300 HAT
  • p300
  • RSTS2

Background

EP300 - E1A binding protein p300

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
MCG10 Antibody -
BSA Free
NBP1-76729
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Western Blot MCG10 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
PCAF Antibody
(5E11)
H00008850-M04
Immunocytochemistry/ Immunofluorescence PCAF Antibody (5E11)
Sandwich ELISA PCAF Antibody (5E11)
Western Blot PCAF Antibody (5E11)
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
ELK3 Antibody
(OTI1H3)
NBP2-01264
Western Blot ELK3 Antibody (OTI1H3)
Flow Cytometry ELK3 Antibody (OTI1H3)
Western Blot ELK3 Antibody (OTI1H3)
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
EBPL Antibody
NBP2-13943
Immunohistochemistry-Paraffin EBPL Antibody
Immunocytochemistry/ Immunofluorescence EBPL Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
SRC1 Antibody
(1135)
NB200-310
Western Blot SRC1 Antibody (1135)
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Airway
Trypsin-like Protease ...
2695-SE
Airway Trypsin-like Protease/HAT/TMPRSS11D
(4 Publications)
Species: Hu
Applications: EnzAct
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA

Publications for KAT3B/p300 Partial Recombinant Protein (H00002033-Q01) (0)

There are no publications for KAT3B/p300 Partial Recombinant Protein (H00002033-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT3B/p300 Partial Recombinant Protein (H00002033-Q01) (0)

There are no reviews for KAT3B/p300 Partial Recombinant Protein (H00002033-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAT3B/p300 Partial Recombinant Protein (H00002033-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KAT3B/p300 Products

Research Areas for KAT3B/p300 Partial Recombinant Protein (H00002033-Q01)

Find related products by research area.

Blogs on KAT3B/p300

There are no specific blogs for KAT3B/p300, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KAT3B/p300 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol EP300