KAL1 Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KAL1 (NP_000207.2). LEVKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLAN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ANOS1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
76 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for KAL1 Antibody - Azide and BSA Free
Background
KAL1 is a gene which codes for a protein that is expressed in the cerebellum and plays an important role in the patterning of cell collaterals to the olfactory cortex while also working as a chemo-attractant for fetal olfactory cells, with a length of 680 amino acids, and a weight of approximately 76 kDa. Studies are being conducted on diseases and disorders related to this gene including Kallmann syndrome, x-linked ichtyhosis, typhus, vesicoureteral reflux, delayed puberty, tooth agenesis, gonadotropin deficiency, charge syndrome, and atopic dermatitis. KAL1 has also been shown to have interactions with SDC2, FGFR1, FGF2, and FGFR2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Bv, Gt, Hu, Po
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: BA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: EnzAct
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for KAL1 Antibody (NBP3-03937) (0)
There are no publications for KAL1 Antibody (NBP3-03937).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KAL1 Antibody (NBP3-03937) (0)
There are no reviews for KAL1 Antibody (NBP3-03937).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KAL1 Antibody (NBP3-03937) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KAL1 Products
Research Areas for KAL1 Antibody (NBP3-03937)
Find related products by research area.
|
Blogs on KAL1