Home » Integrin beta 2/CD18 » Integrin beta 2/CD18 Proteins » Integrin beta 2/CD18 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Integrin beta 2/CD18 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Integrin beta 2/CD18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGB2.

Source: E. coli

Amino Acid Sequence: LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88127.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin beta 2/CD18 Recombinant Protein Antigen

  • 959 beta subunit precursor)10
  • CD18 antigen
  • CD18
  • CD18beta 2
  • cell surface adhesion glycoprotein (LFA-1
  • CR3
  • Integrin beta 2
  • integrin beta-2
  • integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1;macrophage antigen 1 (mac-1) beta subunit)
  • integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
  • ITGB2
  • LAD
  • LCAMB
  • leukocyte cell adhesion molecule CD18
  • leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C
  • LFA-1 beta
  • LFA-1
  • MAC-1 beta
  • MF17
  • MFI7
  • P150
  • p150,95 beta

Background

CD18 is an integrin. Integrins are integral cell surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA1, and combines with the alpha M chain to form the integrin Mac1. Integrins are known to participate in cell adhesion as well as cell surface mediated signalling. CD18 is expressed by most leucocytes. Defects in the CD18 gene result in leukocyte adhesion deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(85 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(111 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Integrin alpha
L/CD11a Antibody (345 ...
MAB3595
Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
L-Selectin/CD62L
Antibody (4G8) [Uncon ...
BBA24
Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]
(9 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD11c Antibody
(AP-MAB0806) - Azide ...
NB110-97871
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
(14 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry CD2 Antibody (RPA-2.10)
Flow Cytometry CD2 Antibody (RPA-2.10)
Flow Cytometry CD2 Antibody (RPA-2.10)
(1 Review)
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
CD58/LFA-3
Antibody (TS2/9) - Az ...
NBP2-22542
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
(1 Publication)
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
(1 Review)
(60 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(445 Publications)
Species: Hu
Applications: BA
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(44 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Integrin beta
2/CD18 Recombinant Pr ...
NBP1-88127PEP
Integrin beta 2/CD18 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP) (0)

There are no publications for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP) (0)

There are no reviews for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin beta 2/CD18 Products

Research Areas for Integrin beta 2/CD18 Recombinant Protein Antigen (NBP1-88127PEP)

Find related products by research area.

Blogs on Integrin beta 2/CD18.

Check out the latest blog posts on Integrin beta 2/CD18.
CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies
The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin beta 2/CD18 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGB2