![Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining in human placenta and cerebral cortex tissues . Corresponding IDO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Immunohistochemistry-Paraffin-NBP1-87702-img0016.jpg "Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining in human placenta and cerebral cortex tissues . Corresponding IDO1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IDO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87702)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Analysis in human cell line EFO-21.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Western-Blot-NBP1-87702-img0013.jpg "Western Blot: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Analysis in human cell line EFO-21.")
![Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Immunohistochemistry-Paraffin-NBP1-87702-img0018.jpg "Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in endothelial cells.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Immunohistochemistry-Paraffin-NBP1-87702-img0009.jpg "Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human cerebral cortex shows no positivity as expected.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Immunohistochemistry-Paraffin-NBP1-87702-img0010.jpg "Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human cerebral cortex shows no positivity as expected.")
![Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human small intestine shows strong cytoplasmic and nuclear positivity in a subset of leukocytes.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Immunohistochemistry-Paraffin-NBP1-87702-img0011.jpg "Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human small intestine shows strong cytoplasmic and nuclear positivity in a subset of leukocytes.")
![Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Simple Western lane view shows a specific band for IDO1 in 0.2 mg/ml of OVCAR-3 (left), h. Tonsil, raji, daudi lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Simple-Western-NBP1-87702-img0005.jpg "Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Simple Western lane view shows a specific band for IDO1 in 0.2 mg/ml of OVCAR-3 (left), h. Tonsil, raji, daudi lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Electropherogram image(s) of corresponding Simple Western lane view. Indoleamine 2,3-dioxygenase/IDO antibody was used at 1:20 dilution on OVCAR-3, h. Tonsil, Raji, and Daudi lysate(s).](http://images.novusbio.com/fullsize/Indoleamine-2-3-dioxygenase-IDO-Antibody-Simple-Western-NBP1-87702-img0008.jpg "Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Electropherogram image(s) of corresponding Simple Western lane view. Indoleamine 2,3-dioxygenase/IDO antibody was used at 1:20 dilution on OVCAR-3, h. Tonsil, Raji, and Daudi lysate(s).")
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")