![Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody (M01), clone 2A4-1B5.Lane 1: KPNA1 transfected lysate(60.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Importin-alpha-5-KPNA1-SRP1-Antibody-2A4-1B5-Western-Blot-H00003836-M01-img0013.jpg "Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody (M01), clone 2A4-1B5.Lane 1: KPNA1 transfected lysate(60.2 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC, IP |
| Clone | 2A4-1B5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL |
| Specificity | KPNA1 - karyopherin alpha 1 (importin alpha 5) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | KPNA1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. ICC/IF usage reported in scientific literature (PMID: 21741962). Use in immunoprecipitation reported in scientific literature (PMID: 26052702). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Human | 07/01/2009 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Analysis of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.](http://images.novusbio.com/fullsize/Importin-alpha-5-KPNA1-SRP1-Antibody-2A4-1B5-Immunohistochemistry-Paraffin-H00003836-M01-img0010.jpg "Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Analysis of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.")
![Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - KPNA1 monoclonal antibody (M01), clone 2A4-1B5 Analysis of KPNA1 expression in HeLa.](http://images.novusbio.com/fullsize/Importin-alpha-5-KPNA1-SRP1-Antibody-2A4-1B5-Western-Blot-H00003836-M01-img0012.jpg "Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - KPNA1 monoclonal antibody (M01), clone 2A4-1B5 Analysis of KPNA1 expression in HeLa.")
![ELISA: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Detection limit for recombinant GST tagged KPNA1 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Importin-alpha-5-KPNA1-SRP1-Antibody-2A4-1B5-ELISA-H00003836-M01-img0011.jpg "ELISA: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Detection limit for recombinant GST tagged KPNA1 is approximately 1ng/ml as a capture antibody.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")