Home » HNF-3 alpha/FoxA1 » HNF-3 alpha/FoxA1 Proteins » HNF-3 alpha/FoxA1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HNF-3 alpha/FoxA1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HNF-3 alpha/FoxA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FOXA1.

Source: E. coli

Amino Acid Sequence: QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOXA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38628.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HNF-3 alpha/FoxA1 Recombinant Protein Antigen

  • forkhead box A1
  • Forkhead box protein A1
  • FoxA1
  • hepatocyte nuclear factor 3, alpha
  • hepatocyte nuclear factor 3-alpha
  • HNF3 alpha
  • HNF-3 alpha
  • HNF-3A
  • HNF-3-alpha
  • HNF3ATCF-3A
  • MGC33105
  • TCF3A
  • Transcription factor 3A

Background

FOXA1 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(98 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
FOXA3 Antibody
NBP2-87461
Immunohistochemistry FOXA3 Antibody
Western Blot FOXA3 Antibody
Western Blot FOXA3 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Immunoprecipitation HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
FoxM1 Antibody
AF3975
Western Blot FoxM1 Antibody
Immunocytochemistry FoxM1 Antibody
Western Blot FoxM1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/ Immunofluorescence TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Amphiregulin
Antibody
AF262
Neutralization Amphiregulin Antibody
Immunocytochemistry Amphiregulin Antibody
Immunohistochemistry Amphiregulin Antibody
(1 Review)
(35 Publications)
Species: Hu
Applications: ICC, IHC, Neut, WB

Uteroglobin/SCGB1A1 An ...
MAB4218
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: IHC, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(90 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
GATA-3 Antibody
[Unconjugated]
AF2605
Western Blot GATA-3 Antibody [Unconjugated]
Immunocytochemistry GATA-3 Antibody [Unconjugated]
Simple Western GATA-3 Antibody [Unconjugated]
(43 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
HNF-3 alpha/FoxA1
Recombinant Protein A ...
NBP2-38628PEP
HNF-3 alpha/FoxA1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP) (0)

There are no publications for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP) (0)

There are no reviews for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HNF-3 alpha/FoxA1 Products

Research Areas for HNF-3 alpha/FoxA1 Protein (NBP2-38628PEP)

Find related products by research area.

Blogs on HNF-3 alpha/FoxA1

There are no specific blogs for HNF-3 alpha/FoxA1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HNF-3 alpha/FoxA1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FOXA1