Novus Biologicals products are now on bio-techne.com

HIC1 Antibody (1F2)

Name: HIC1 Antibody (1F2)
Brand: Novus Biologicals
SKU: H00003090-M05
Price: 519 USD

Submit a Review

Images

(

Enlarge)

Western Blot: HIC1 Antibody (1F2) [H00003090-M05] - Detection against Immunogen (34.32 KDa) .

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA
Clone	1F2
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HIC1 Antibody (1F2) Summary

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Specificity	HIC1 (1F2)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	HIC1
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Western Blot
Application Notes	Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIC1 Antibody (1F2)

hic-1
hypermethylated in cancer 1
ZBTB29hypermethylated in cancer 1 protein
Zinc finger and BTB domain-containing protein 29
ZNF901

Background

Transcriptional repressor. May act as a tumor suppressor. May be involved in development of head, face, limbsand ventral body wall

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

RASSF1 Antibody
(OTI2B11)

NBP2-03644

Immunohistochemistry-Paraffin RASSF1 Antibody (OTI2B11)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...

NBP1-51641

Flow Cytometry Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free

Immunocytochemistry/ Immunofluorescence Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free

(9 Publications)

Species: Hu, Mu, Pm, Rb, Rt

Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB

MGMT Antibody (MT
23.2) - BSA Free

NB100-168

Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free

(21 Publications)

Species: Hu, Mu(-)

Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

p15INK4b/CDKN2B
Antibody (OTI3B6)

NBP2-45603

Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

E-Cadherin
Antibody [Unconjugate

AF748

Immunohistochemistry E-Cadherin Antibody [Unconjugated]

(142 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB

SUB1 Antibody

NBP1-82454

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

APC Antibody - BSA
Free

NB100-91662

Immunohistochemistry-Paraffin APC Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

MLH1 Antibody
(SP08-04)

NBP2-67381

Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)

Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB

Coagulation Factor
XIV/Protein C Antibod ...

AF4885

(2 Publications)

Species: Mu

Applications: IP, WB

FZR1/CDH1 Antibody

NBP2-15840

Immunocytochemistry/ Immunofluorescence FZR1/CDH1 Antibody

Immunohistochemistry-Paraffin FZR1/CDH1 Antibody

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

DAP Kinase 1
Antibody (SR1225)

NBP3-21649

Western Blot DAP Kinase 1 Antibody (SR1225)

Immunocytochemistry/ Immunofluorescence DAP Kinase 1 Antibody (SR1225)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

Glutathione
S-Transferase pi 1/GS ...

NBP2-16756

Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody

Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody

(1 Review)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

ER alpha/NR3A1
Antibody (33)

NB300-560

Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)

Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)

(1 Review)

(11 Publications)

Species: Av, Bv, Ma, Hu, Mu, Pm, Rt

Applications: IF, IHC, IHC-Fr, IHC-P, WB

NXT1 Antibody
(4F11)

H00029107-M08

Immunocytochemistry/ Immunofluorescence NXT1 Antibody (4F11)

Species: Hu

Applications: ELISA, ICC/IF, KD, S-ELISA, WB

RUNX3/CBFA3
Antibody (527327) [Un ...

MAB3765

Western Blot RUNX3/CBFA3 Antibody (527327) [Unconjugated]

Simple Western RUNX3/CBFA3 Antibody (527327) [Unconjugated]

(6 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB

MRPL28 Antibody

NBP3-38209

Species: Hu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

SOCS-1 Antibody

NB100-56637

(1 Review)

(5 Publications)

Species: Hu, Mu

Applications: WB

IGF-II/IGF2
[Unconjugated]

292-G2

(48 Publications)

Species: Hu

Applications: BA

Publications for HIC1 Antibody (H00003090-M05) (0)

There are no publications for HIC1 Antibody (H00003090-M05).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIC1 Antibody (H00003090-M05) (0)

There are no reviews for HIC1 Antibody (H00003090-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIC1 Antibody (H00003090-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional HIC1 Products

Research Areas for HIC1 Antibody (H00003090-M05)

Find related products by research area.

Cell Cycle and Replication

Blogs on HIC1

There are no specific blogs for HIC1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our HIC1 Antibody (1F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol	HIC1
Entrez	3090(Human)
OMIM	603825(Human)
Uniprot	NP_006488(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HIC1 Antibody (1F2)

Species Glossary

Images

Product Details

Order Details

HIC1 Antibody (1F2) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for HIC1 Antibody (1F2)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HIC1 Antibody (H00003090-M05) (0)

Reviews for HIC1 Antibody (H00003090-M05) (0)

Product General Protocols

Video Protocols

FAQs for HIC1 Antibody (H00003090-M05) (0)

Secondary Antibodies

Isotype Controls

Additional HIC1 Products

Research Areas for HIC1 Antibody (H00003090-M05)

Blogs on HIC1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics