HAP1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HAP1. Peptide sequence: ETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYS The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HAP1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for HAP1 Antibody
Background
Huntington's disease is an autosomal dominant neurodegenerative disorder caused by an expanded polyglutamine repeat region in the huntingtin gene. Huntingtin-associated protein 1 (HAP1) is a huntingtin associated protein that shows neuronal localization and moves with huntingtin in nerve fibers. The ability of HAP1 to bind to huntingtin is enhanced by the expanded polyglutamine repeat region that is typical of the mutant form of the protein associated with Huntington's disease.
Defects with HAP1 can lead to Huntington's disease, and HAP1 antibodies are therefore useful tools for Huntington's disease research and neuroscience studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for HAP1 Antibody (NBP2-86664) (0)
There are no publications for HAP1 Antibody (NBP2-86664).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HAP1 Antibody (NBP2-86664) (0)
There are no reviews for HAP1 Antibody (NBP2-86664).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HAP1 Antibody (NBP2-86664) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HAP1 Products
Research Areas for HAP1 Antibody (NBP2-86664)
Find related products by research area.
|
Blogs on HAP1