![Western Blot: GPT2 Antibody [NBP2-14072] - Analysis in human cell lines Caco-2 and HeLa using anti-GPT2 antibody. Corresponding GPT2 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/GPT2-Antibody-Western-Blot-NBP2-14072-img0020.jpg "Western Blot: GPT2 Antibody [NBP2-14072] - Analysis in human cell lines Caco-2 and HeLa using anti-GPT2 antibody. Corresponding GPT2 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA |
| Predicted Species | Mouse (92%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GPT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 and h. Kidney lysates, separated by Size, antibody dilution of 1:25, apparent MW was 59 kDa |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RII_AF241NA_Western_Blot_21284.jpg)
![Neutralization TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Block_Neutralize_8662.jpg)
![Immunohistochemistry TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Immunohistochemistry_9941.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GPT2 |
![Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/GPT2-Antibody-Immunohistochemistry-Paraffin-NBP2-14072-img0017.jpg "Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.")
![Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GPT2-Antibody-Immunohistochemistry-Paraffin-NBP2-14072-img0014.jpg "Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/GPT2-Antibody-Immunohistochemistry-Paraffin-NBP2-14072-img0015.jpg "Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human lymph node shows very weak positivity in lymphoid cells.](http://images.novusbio.com/fullsize/GPT2-Antibody-Immunohistochemistry-Paraffin-NBP2-14072-img0016.jpg "Immunohistochemistry-Paraffin: GPT2 Antibody [NBP2-14072] - Staining of human lymph node shows very weak positivity in lymphoid cells.")
![Simple Western: GPT2 Antibody [NBP2-14072] - Simple Western lane view shows a specific band for GPT2 in 0.2 mg/ml of HepG2 (left) and h. Kidney (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/GPT2-Antibody-Simple-Western-NBP2-14072-img0004.jpg "Simple Western: GPT2 Antibody [NBP2-14072] - Simple Western lane view shows a specific band for GPT2 in 0.2 mg/ml of HepG2 (left) and h. Kidney (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: GPT2 Antibody [NBP2-14072] - Electropherogram image of the corresponding Simple Western lane view. GPT2 antibody was used at 1:25 dilution on HepG2 and h. Kidney lysate(s) respectively.](http://images.novusbio.com/fullsize/GPT2-Antibody-Simple-Western-NBP2-14072-img0005.jpg "Simple Western: GPT2 Antibody [NBP2-14072] - Electropherogram image of the corresponding Simple Western lane view. GPT2 antibody was used at 1:25 dilution on HepG2 and h. Kidney lysate(s) respectively.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")