![Western Blot: GPR177/WLS Antibody [NBP2-85009] - WB Suggested Anti-GPR177 Antibody Titration: 0.5ug/ml. Positive Control: Jurkat cell lysate](http://images.novusbio.com/fullsize/GPR177-WLS-Antibody-Western-Blot-NBP2-85009-img0002.jpg "Western Blot: GPR177/WLS Antibody [NBP2-85009] - WB Suggested Anti-GPR177 Antibody Titration: 0.5ug/ml. Positive Control: Jurkat cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human GPR177/WLS. Peptide sequence: ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WLS |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GPR177/WLS Antibody (NBP2-85009)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WLS |
![Immunohistochemistry: GPR177/WLS Antibody [NBP2-85009] - Human Muscle](http://images.novusbio.com/fullsize/GPR177-WLS-Antibody-Immunohistochemistry-NBP2-85009-img0001.jpg "Immunohistochemistry: GPR177/WLS Antibody [NBP2-85009] - Human Muscle")
![Western Blot: GPR177/WLS Antibody [NBP2-85009] - Host: Rabbit. Target Name: GPR177. Sample Type: Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml. Peptide Concentration: 5ug/ml. Lysate Quantity: 25ug/lane/lane. Gel Concentra](http://images.novusbio.com/fullsize/GPR177-WLS-Antibody-Western-Blot-NBP2-85009-img0003.jpg "Western Blot: GPR177/WLS Antibody [NBP2-85009] - Host: Rabbit. Target Name: GPR177. Sample Type: Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml. Peptide Concentration: 5ug/ml. Lysate Quantity: 25ug/lane/lane. Gel Concentra")
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
