![Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Analysis in human bone marrow and pancreas tissues using NBP1-84597 antibody. Corresponding GYPC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Glycophorin-C-Antibody-Immunohistochemistry-Paraffin-NBP1-84597-img0008.jpg "Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Analysis in human bone marrow and pancreas tissues using NBP1-84597 antibody. Corresponding GYPC RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GYPC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Glycophorin C Antibody (NBP1-84597)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GYPC |
![Western Blot: Glycophorin C Antibody [NBP1-84597] - Analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Glycophorin-C-Antibody-Western-Blot-NBP1-84597-img0007.jpg "Western Blot: Glycophorin C Antibody [NBP1-84597] - Analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Glycophorin-C-Antibody-Immunohistochemistry-Paraffin-NBP1-84597-img0011.jpg "Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human bone marrow shows strong membranous positivity in erythrocytes.](http://images.novusbio.com/fullsize/Glycophorin-C-Antibody-Immunohistochemistry-Paraffin-NBP1-84597-img0009.jpg "Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human bone marrow shows strong membranous positivity in erythrocytes.")
![Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human placenta shows strong membranous positivity in erythrocytes.](http://images.novusbio.com/fullsize/Glycophorin-C-Antibody-Immunohistochemistry-Paraffin-NBP1-84597-img0010.jpg "Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human placenta shows strong membranous positivity in erythrocytes.")
![Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Glycophorin-C-Antibody-Immunohistochemistry-Paraffin-NBP1-84597-img0012.jpg "Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")