![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Analysis in human duodenum and pancreas tissues using NBP1-89727 antibody. Corresponding Glutathione S Transferase kappa 1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0009.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Analysis in human duodenum and pancreas tissues using NBP1-89727 antibody. Corresponding Glutathione S Transferase kappa 1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSTK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89727 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSTK1 |
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0002.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0005.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0006.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human small intestine shows high expression.")
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0008.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human small intestine shows high expression.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")