![Immunocytochemistry/Immunofluorescence: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human cell line A-431 shows localization to peroxisomes.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89726-img0007.jpg "Immunocytochemistry/Immunofluorescence: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human cell line A-431 shows localization to peroxisomes.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSTK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol NBP1-89726 |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89726-img0011.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89726-img0008.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89726-img0009.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89726-img0010.jpg "Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89726] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")