![Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining in human kidney and skeletal muscle tissues using NBP1-89766 antibody. Corresponding GLS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-89766-img0015.jpg "Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining in human kidney and skeletal muscle tissues using NBP1-89766 antibody. Corresponding GLS RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Glutaminase Antibody (NBP1-89766)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GLS |
![Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male and female rats. GLT protein was measured by Western blot in the caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, and Lz/INS groups of male (M; left-hand side) and female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values +/- S.E.M. VMN = Ventromedial hypothalamic nucleus; V = Vehicle; L = letrozole; INS = insulin. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Western-Blot-NBP1-89766-img0016.jpg "Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male and female rats. GLT protein was measured by Western blot in the caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, and Lz/INS groups of male (M; left-hand side) and female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values +/- S.E.M. VMN = Ventromedial hypothalamic nucleus; V = Vehicle; L = letrozole; INS = insulin. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883/) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining of human cell line SiHa shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89766-img0007.jpg "Immunocytochemistry/Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining of human cell line SiHa shows localization to mitochondria. Antibody staining is shown in green.")
![Western Blot: Glutaminase Antibody [NBP1-89766] - Analysis in human cell line EFO-21.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Western-Blot-NBP1-89766-img0006.jpg "Western Blot: Glutaminase Antibody [NBP1-89766] - Analysis in human cell line EFO-21.")
![Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-89766-img0011.jpg "Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-89766-img0012.jpg "Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-89766-img0013.jpg "Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Glutaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-89766-img0014.jpg "Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based patterns of glycogen phosphorylase-muscle type (GPmm) Protein expression in icv Lz-pretreated male & female rats. GPmm protein was measured by Western blot in the rostral (a; F(7,40) = 35.87; p < 0.0001), middle (b; F(7,40) = 33.89; p < 0.0001), & caudal (c; F(7,40) = 9.43; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89766_rabbit-polyclonal-glutaminase-antibody-310202415175258.jpg "Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based patterns of glycogen phosphorylase-muscle type (GPmm) Protein expression in icv Lz-pretreated male & female rats. GPmm protein was measured by Western blot in the rostral (a; F(7,40) = 35.87; p < 0.0001), middle (b; F(7,40) = 33.89; p < 0.0001), & caudal (c; F(7,40) = 9.43; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89766_rabbit-polyclonal-glutaminase-antibody-310202415371919.jpg "Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89766_rabbit-polyclonal-glutaminase-antibody-310202415171322.jpg "Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89766_rabbit-polyclonal-glutaminase-antibody-31020241536372.jpg "Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by Western blot in the rostral (a; F(7,40) = 12.20; p < 0.0001), middle (b; F(7,40) = 17.39; p < 0.0001), & caudal (c; F(7,40) = 11.67; p < 0.0001) VMN of V/V, V/INS, Lz/V, & Lz/INS groups of male (M; left-hand side) & female (F; right-hand side) rats. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. For each VMN segment, data depict mean normalized GAD O.D. values ± S.E.M. Results are summarized in the table at bottom; ↑ & ↓ denote a relative increase or decrease, respectively, between treatment groups; no change (NC) between groups is also indicated Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33238883), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")