Home » GDF-3 » GDF-3 Proteins » GDF-3 Recombinant Protein Antigen

GDF-3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GDF-3 Protein (NBP1-86443PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

GDF-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GDF3.

Source: E. coli

Amino Acid Sequence: HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GDF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86443.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GDF-3 Recombinant Protein Antigen

  • GDF3
  • GDF-3
  • growth differentiation factor 3
  • growth/differentiation factor 3
  • KFS3
  • MCOP7
  • MCOPCB6
  • Vgr-2

Background

GDF3 is encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(312 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
CRIPTO Antibody
[Unconjugated]
AF1538
Immunocytochemistry CRIPTO Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: Block, ICC, WB
GDF-1 Antibody
(748450) [Unconjugate
MAB6937
Western Blot GDF-1 Antibody (748450) [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
ALK-7/Activin
Receptor Type 1C Anti ...
MAB5771
Flow Cytometry ALK-7/Activin Receptor Type 1C Antibody (118311) [Unconjugated]
(1 Review)
Species: Rt
Applications: CyTOF-ready, Flow, WB
GDF-9
[Unconjugated]
739-G9
Bioactivity GDF-9 [Unconjugated]
(15 Publications)
Species: Mu
Applications: BA
BMP-7
[Unconjugated]
354-BP
Bioactivity BMP-7 [Unconjugated]
Cell Culture BMP-7 [Unconjugated]
(96 Publications)
Species: Hu
Applications: BA
BMP-6
[Unconjugated]
507-BP
SDS-PAGE BMP-6 [Unconjugated]
Bioactivity BMP-6 [Unconjugated]
(72 Publications)
Species: Hu
Applications: BA
Nodal
[Unconjugated]
3218-ND
Nodal [Unconjugated]
(22 Publications)
Species: Hu
Applications: BA
Activin RIB/ALK-4
Antibody (3U6I8)
NBP3-16106
Immunohistochemistry-Paraffin Activin RIB/ALK-4 Antibody (3U6I8)
Immunohistochemistry-Paraffin Activin RIB/ALK-4 Antibody (3U6I8)
Immunohistochemistry-Paraffin Activin RIB/ALK-4 Antibody (3U6I8)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DNMT3B Antibody
NB300-516
Western Blot DNMT3B Antibody
Western Blot DNMT3B Antibody
Western Blot DNMT3B Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
GDF-8/Myostatin
[Unconjugated]
788-G8/CF
SDS-PAGE GDF-8/Myostatin [Unconjugated]
Bioactivity GDF-8/Myostatin [Unconjugated]
(40 Publications)
Species: Hu, Mu, Rt
Applications: BA
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(379 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Rex-1/ZFP42
Antibody (5E11A6) - B ...
NBP2-37357
ELISA Rex-1/ZFP42 Antibody (5E11A6) - BSA Free
Western Blot Rex-1/ZFP42 Antibody (5E11A6) - BSA Free
Western Blot Rex-1/ZFP42 Antibody (5E11A6) - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
GDF-6/BMP-13
855-G6
GDF-6/BMP-13
(4 Publications)
Species: Mu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(863 Publications)
Species: Hu
Applications: BA
BMP-2
[Unconjugated]
355-BM
Bioactivity BMP-2 [Unconjugated]
(191 Publications)
Species: Hu, Mu, Rt
Applications: BA
CD9 Antibody
(MEM-61) - BSA Free
NB500-327
Flow Cytometry CD9 Antibody (MEM-61) - BSA Free
Flow Cytometry CD9 Antibody (MEM-61) - BSA Free
Flow Cytometry CD9 Antibody (MEM-61) - BSA Free
(1 Review)
(16 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Stella/Dppa3
Antibody [Unconjugate
AF2566
Immunohistochemistry Stella/Dppa3 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB

Publications for GDF-3 Protein (NBP1-86443PEP) (0)

There are no publications for GDF-3 Protein (NBP1-86443PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-3 Protein (NBP1-86443PEP) (0)

There are no reviews for GDF-3 Protein (NBP1-86443PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GDF-3 Protein (NBP1-86443PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GDF-3 Products

Research Areas for GDF-3 Protein (NBP1-86443PEP)

Find related products by research area.

Blogs on GDF-3

There are no specific blogs for GDF-3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GDF-3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GDF3