Home » Galectin-9 » Galectin-9 Proteins » Galectin-9 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Galectin-9 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Galectin-9 Protein (NBP2-33484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Galectin-9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGALS9.

Source: E. coli

Amino Acid Sequence: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGALS9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33484.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Galectin-9 Recombinant Protein Antigen

  • Ecalectin
  • GAL9
  • gal-9
  • galectin 9
  • Galectin9
  • Galectin-9
  • HUAT
  • lectin, galactoside-binding, soluble, 9
  • LGALS9
  • LGALS9A
  • MGC117375
  • MGC125973
  • MGC125974
  • Tumor antigen HOM-HD-21
  • urate transporter/channel protein

Background

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin 9 is an S-type lectin and an eosinophil chemoattractant (ECA) produced by antigen-activated T cells. Galectin 9 is involved in apoptosis, is thought to be a prognostic factor for breast cancer and is also overexpressed in Hodgkin's disease tissue. The protein has N- and C- terminal carbohydrate-binding domains connected by a link peptide. Multiple alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIM-3 Antibody
[Unconjugated]
AF2365
Immunohistochemistry TIM-3 Antibody [Unconjugated]
Dual RNAscope ISH-IHC Compatible TIM-3 Antibody [Unconjugated]
Knockout Validated TIM-3 Antibody [Unconjugated]
(2 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Galectin-8
Antibody [Unconjugate
AF1305
Western Blot Galectin-8 Antibody [Unconjugated]
Simple Western Galectin-8 Antibody [Unconjugated]
Immunohistochemistry Galectin-8 Antibody [Unconjugated]
(1 Review)
(30 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Galectin-3
Antibody [Unconjugate
AF1197
Western Blot Galectin-3 Antibody [Unconjugated]
Immunohistochemistry Galectin-3 Antibody [Unconjugated]
Simple Western Galectin-3 Antibody [Unconjugated]
(2 Reviews)
(42 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
FoxP3 Antibody -
BSA Free
NB100-39002
Flow Cytometry FoxP3 Antibody - BSA Free
Flow Cytometry FoxP3 Antibody - BSA Free
Immunohistochemistry-Paraffin FoxP3 Antibody - BSA Free
(2 Reviews)
(62 Publications)
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
TIM-1/KIM-1/HAVCR
Antibody [Unconjugate ...
AF1817
Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]
Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]
(104 Publications)
Species: Mu
Applications: WB
CRX/CORD2 Antibody
(4G11)
H00001406-M02
Western Blot CRX/CORD2 Antibody (4G11)
Immunocytochemistry/ Immunofluorescence CRX/CORD2 Antibody (4G11)
ELISA CRX/CORD2 Antibody (4G11)
(32 Publications)
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
RPGR Antibody -
Azide and BSA Free
NBP2-93653
Western Blot RPGR Antibody - Azide and BSA Free
Western Blot RPGR Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin RPGR Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
CCL11/Eotaxin [HRP]
MME00
N/A CCL11/Eotaxin [HRP]
N/A CCL11/Eotaxin [HRP]
(57 Publications)
Species: Mu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Galectin-9
Recombinant Protein A
NBP2-33484PEP
Galectin-9 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Galectin-9 Protein (NBP2-33484PEP) (0)

There are no publications for Galectin-9 Protein (NBP2-33484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-9 Protein (NBP2-33484PEP) (0)

There are no reviews for Galectin-9 Protein (NBP2-33484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-9 Protein (NBP2-33484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Galectin-9 Products

Research Areas for Galectin-9 Protein (NBP2-33484PEP)

Find related products by research area.

Blogs on Galectin-9

There are no specific blogs for Galectin-9, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Galectin-9 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with Calcium Ionomycin and PMA using Goat Anti-Human Galectin-9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2045) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Galectin-9 Antibody [Unconjugated]
AF2045

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-9 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LGALS9